Tervetuloa Messukeskukseen – Suomen suurimpaan ja monipuolisimpaan tapahtumapaikkaan. Tutustu tapahtumiimme, tiloihimme sekä Messukeskukseen yrityksenä!

1.67 Rating by ClearWebStats
messukeskushelsinki.fi is 1 decade 1 year 7 months old. This website has a #525,504 rank in global traffic. It has a .fi as an domain extension. This domain is estimated value of $ 1,440.00 and has a daily earning of $ 6.00. While no active threats were reported recently by users, messukeskushelsinki.fi is SAFE to browse.
Get Custom Widget

Traffic Report of Messukeskushelsinki

Daily Unique Visitors: 916
Daily Pageviews: 1,832

Estimated Valuation

Income Per Day: $ 6.00
Estimated Worth: $ 1,440.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 525,504
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
36
Siteadvisor Rating
View messukeskushelsinki.fi site advisor rating Not Applicable

Where is messukeskushelsinki.fi server located?

Hosted IP Address:

77.86.189.241 View other site hosted with messukeskushelsinki.fi

Hosted Country:

messukeskushelsinki.fi hosted country FI messukeskushelsinki.fi hosted country

Location Latitude:

60.1695

Location Longitude:

24.9354

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View messukeskushelsinki.fi HTML resources

Homepage Links Analysis

Messukeskus | Etusivu

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 96
H3 Headings: Not Applicable H4 Headings: 7
H5 Headings: 10 H6 Headings: Not Applicable
Total IFRAMEs: 2 Total Images: 15
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 77.86.189.241)

Home - CyberSecurity Nordic

messukeskushelsinki.fi favicon - cybersecuritynordic.com

View messukeskushelsinki.fi Pagerank   messukeskushelsinki.fi alexa rank Not Applicable   messukeskushelsinki.fi website value $ 8.95

ViherTek - 12.-14.10.2016 Messukeskus, Helsinki

messukeskushelsinki.fi favicon - vihertek.fi

ViherTek on ympäristösuunnittelun, -rakentamisen ja -hoidon vuoden tärkein ammattitapahtuma.

View messukeskushelsinki.fi Pagerank   messukeskushelsinki.fi alexa rank Not Applicable   messukeskushelsinki.fi website value $ 8.95

Kiinteistö 26. - 27.9.2017 Messukeskus Helsinki

messukeskushelsinki.fi favicon - kiinteistomessut.fi

Kiinteistönhoidon, isännöinnin ja kiinteistöjen peruskorjauksen vuoden tärkein tapahtuma 26.-27.9.2017 Messukeskuksessa Helsingissä.

View messukeskushelsinki.fi Pagerank   messukeskushelsinki.fi alexa rank Not Applicable   messukeskushelsinki.fi website value $ 8.95

FinnSec 26.-27.9.2017 Messukeskus Helsinki

messukeskushelsinki.fi favicon - finnsec.fi

Pohjoismaiden suurin turvallisuusalan tapahtuma 26.-27.9.2017. Tapahtumassa kohtaavat alan päättäjät ja tekijät sekä yritysten turvallisuudesta vastaavat

View messukeskushelsinki.fi Pagerank   messukeskushelsinki.fi alexa rank Not Applicable   messukeskushelsinki.fi website value $ 8.95

Hammaslääkäripäivät | Messukeskus | 24. - 26.11.2016

messukeskushelsinki.fi favicon - hammaslaakaripaivatnayttely.fi

Suomen suurin hammaslääketieteen koulutustapahtuma ja näytttely. Kouluttaudu, kehity ja verkostoidu suun hoidon suurimmassa ammattitapahtumassa.

View messukeskushelsinki.fi Pagerank   messukeskushelsinki.fi alexa rank Not Applicable   messukeskushelsinki.fi website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 08 Aug 2016 10:09:20 GMT
Content-Type: text/html; charset=UTF-8
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Link: ; rel=shortlink
X-UA-Compatible: IE=Edge
X-Varnish: 796400 985121
Age: 1578
Via: 1.1 varnish-v4
X-Cache: cached
Content-Length: 89366
Accept-Ranges: bytes

Domain Information for messukeskushelsinki.fi

Domain Registrar: Finnish Communications Regulatory Authority messukeskushelsinki.fi registrar info
Registration Date: 2012-10-10 1 decade 1 year 7 months ago
Expiration Date: 2018-10-10 5 years 7 months 6 days ago

Domain Nameserver Information

Host IP Address Country
ns2.mynebula.fi messukeskushelsinki.fi name server information 217.30.182.225 messukeskushelsinki.fi server is located in Finland Finland
ns1.mynebula.fi messukeskushelsinki.fi name server information 217.30.180.225 messukeskushelsinki.fi server is located in Finland Finland

DNS Record Analysis

Host Type TTL Extra
messukeskushelsinki.fi A 3592 IP:77.86.189.241
messukeskushelsinki.fi NS 3600 Target:ns2.mynebula.fi
messukeskushelsinki.fi NS 3600 Target:ns1.mynebula.fi
messukeskushelsinki.fi SOA 3600 MNAME:ns1.mynebula.fi
RNAME:hostmaster.mynebula.fi
Serial:973744
Refresh:1800
Retry:600
Expire:86400

Similarly Ranked Websites to Messukeskushelsinki

blog-kk-topshop.de - household items

messukeskushelsinki.fi favicon - blog-kk-topshop.de

blog-kk-topshop.de, household items, coffee machines, coolers, espresso maker, blender, cooler bags, mini fridges, toaster, kettle.

View messukeskushelsinki.fi Pagerank   Alexa rank for messukeskushelsinki.fi 525,505   website value of messukeskushelsinki.fi $ 1,440.00

Mobile Advertising | Monetize Mobile Traffic | On-Mobi - Mobile Ad Network

messukeskushelsinki.fi favicon - ck-cdn.com

Mobile Advertising with On-Mobi - Join our premium mobile advertising network specializing in iphone and android apps advertising, and targeted on gaming and finance related traffic. Monetize the mobile traffic on your app, target mobile users, and build brand awareness.

View messukeskushelsinki.fi Pagerank   Alexa rank for messukeskushelsinki.fi 525,505   website value of messukeskushelsinki.fi $ 1,440.00

DIY Now!

messukeskushelsinki.fi favicon - diynow.net

View messukeskushelsinki.fi Pagerank   Alexa rank for messukeskushelsinki.fi 525,505   website value of messukeskushelsinki.fi $ 1,440.00

Edwards Federal Credit Union - Home

messukeskushelsinki.fi favicon - edwardsfcu.org

Edwards Federal Credit Union is headquartered locally, and is open to anyone who lives, works or attends school in the Antelope Valley.

View messukeskushelsinki.fi Pagerank   Alexa rank for messukeskushelsinki.fi 525,505   website value of messukeskushelsinki.fi $ 1,440.00

Index of /

messukeskushelsinki.fi favicon - cyberpayng.com

View messukeskushelsinki.fi Pagerank   Alexa rank for messukeskushelsinki.fi 525,506   website value of messukeskushelsinki.fi $ 1,440.00

Full WHOIS Lookup for messukeskushelsinki.fi

domain: messukeskushelsinki.fi
descr: Suomen Messut Osuuskunta
descr: 01163223
address: Tietohallinto / Sami Nieminen
address: Messuaukio 1, PL 21
address: 00521
address: Helsinki
phone: +358404503250
status: Granted
created: 10.10.2012
modified: 6.10.2015
expires: 10.10.2018
nserver: ns2.mynebula.fi [Technical Check Not Done]
nserver: ns1.mynebula.fi [Technical Check Not Done]
dnssec: no

More information is available at https://domain.fi/
Copyright (c) Finnish Communications Regulatory Authority